Bovine IL-17A Recombinant Protein
Catalogue number:
RP0056B-005
Supplier:
Size:
5 µg _$$_
Product is available in:
£176.00
Estimated delivery Wed 22 May
Shipping is calculated in checkout
Shipping is calculated in checkout
The Bovine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-17A Specifications: (Molecular Weight: 15.0 kDa) (Amino Acid Sequence: (KAGVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRSTNSRRPTDYHKRSTSPWTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHLA) (Gene ID: 282863). For research use only. Made in the USA
- Related Content: Yeast-expressed recombinant proteins
Storage Temperature:
Ambient