Canine SCF Recombinant Protein
Catalogue number:
RP0154D-005
Supplier:
Size:
5 µg _$$_
Product is available in:
£176.00
Estimated delivery Wed 24 Jul
Shipping is calculated in checkout
Shipping is calculated in checkout
The Canine SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine SCF applications are for cell culture, ELISA standard, and Western Blot Control. The Canine SCF yeast-derived recombinant protein can be purchased in multiple sizes. Canine SCF Specifications: (Molecular Weight: 27.7 kDa) (Amino Acid Sequence: GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)) (Gene ID: 403507). For research use only. Made in the USA
- Related Content: Yeast-expressed recombinant proteins
Storage Temperature:
Ambient